(data stored in ACNUC7421 zone)

EMBL: CP000489.PE434

CP000489.PE434       Location/Qualifiers
FT   CDS             406794..407576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_3420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68551"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ57"
FT                   /protein_id="ABL68551.1"
FT                   /translation="MKTLALLFITAAPALAQDLPPGLLSAELLPGWTTSQGHRMTALHL
FT                   RLEPGWKTYWRSPGDAGVPPRFDWGGSQNLGEVRLMWPRPEVIESGGERTLGYHDELVL
FT                   PIEIAPASHAAPVEPRAVVDFGICQDICVPVRVELQAGPPGPMPDPVIEAAIARQPETS
FT                   DRQPECRIARIKDGMQVTATLPAADSARGDEVAMELADDEIWVSAPETHAVGNRLTAQA
FT                   EFVAASGQPFPLDPGSLRVTLIGPDDAVEFQGCRVAGD"
     MKTLALLFIT AAPALAQDLP PGLLSAELLP GWTTSQGHRM TALHLRLEPG WKTYWRSPGD        60
     AGVPPRFDWG GSQNLGEVRL MWPRPEVIES GGERTLGYHD ELVLPIEIAP ASHAAPVEPR       120
     AVVDFGICQD ICVPVRVELQ AGPPGPMPDP VIEAAIARQP ETSDRQPECR IARIKDGMQV       180
     TATLPAADSA RGDEVAMELA DDEIWVSAPE THAVGNRLTA QAEFVAASGQ PFPLDPGSLR       240
     VTLIGPDDAV EFQGCRVAGD                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page