(data stored in ACNUC7421 zone)

EMBL: CP000489.PE435

CP000489.PE435       Location/Qualifiers
FT   CDS             complement(407573..408388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0438"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   rsp:RSP_1001 putative DNA polymerase bacteriophage-type"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68552"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ58"
FT                   /protein_id="ABL68552.1"
FT                   /translation="MTADPTYRGFALDAETALALLQWQAELGADEPCLDAPLDRYAMPD
FT                   RAEPSPAPATAAPQAANPRSPVRDEAEDLVARAEAMATAATTLAELAAAQEAFDGIELK
FT                   KGARNFCFCDGNPAARIMIIGEAPGEEEDRQGRPFVGRAGQLLDQMFGAIGLSREAVDA
FT                   ERALYITNVLTWRPPGNRRPEPAEIAMMLPFLTRHVELAQPQLLVLMGNTPCIAALNQQ
FT                   GILKLRGKWTTAFGLPALPMAHPAYLLRTPLAKREAWADLLSLSARLEG"
     MTADPTYRGF ALDAETALAL LQWQAELGAD EPCLDAPLDR YAMPDRAEPS PAPATAAPQA        60
     ANPRSPVRDE AEDLVARAEA MATAATTLAE LAAAQEAFDG IELKKGARNF CFCDGNPAAR       120
     IMIIGEAPGE EEDRQGRPFV GRAGQLLDQM FGAIGLSREA VDAERALYIT NVLTWRPPGN       180
     RRPEPAEIAM MLPFLTRHVE LAQPQLLVLM GNTPCIAALN QQGILKLRGK WTTAFGLPAL       240
     PMAHPAYLLR TPLAKREAWA DLLSLSARLE G                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page