(data stored in ACNUC7421 zone)

EMBL: CP000489.PE44

CP000489.PE44        Location/Qualifiers
FT   CDS             35726..36292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sit:TM1040_3505 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68161"
FT                   /db_xref="GOA:A1AY17"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY17"
FT                   /protein_id="ABL68161.1"
FT                   /translation="MRYRSLYFIPVALLLLAGAAVGYTKVMARIGSGQPPAYALPEQQA
FT                   DRIVVSKGDKTMYLLRGDRILKTYRIAMGSNWNQGHKQREGDERTPEGTYRIDWRNPRS
FT                   IAHLSLHVSYPNAEDSERARQAGYSPGGNIMIHGLPNGWGAMGRLHRLLDWTDGCIAVT
FT                   NDEMREIWSLTPNGTSITIKAEWAP"
     MRYRSLYFIP VALLLLAGAA VGYTKVMARI GSGQPPAYAL PEQQADRIVV SKGDKTMYLL        60
     RGDRILKTYR IAMGSNWNQG HKQREGDERT PEGTYRIDWR NPRSIAHLSL HVSYPNAEDS       120
     ERARQAGYSP GGNIMIHGLP NGWGAMGRLH RLLDWTDGCI AVTNDEMREI WSLTPNGTSI       180
     TIKAEWAP                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page