(data stored in ACNUC7421 zone)

EMBL: CP000489.PE441

CP000489.PE441       Location/Qualifiers
FT   CDS             412764..413840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68558"
FT                   /db_xref="InterPro:IPR025683"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ64"
FT                   /protein_id="ABL68558.1"
FT                   /translation="MVLENKSYVPTLAIRASEMNGLEFLPGATKDRMTPCILLAPWANS
FT                   LTLDRAIDRVERAFPNRNYFLDIDRDYQFTNLESGPQQELARLMESDNAFANWVEFVGR
FT                   HENAWPCIQSRGQSEADLRRQIEAIQELGRPYCMRIVRDRFPSNIQEIVAAFAAGGAAD
FT                   FAIILEGGWTRDPLTLSVWFEGVIAESLQEIDAAVPVVLSCTSIPKMFSAFSGITPVPF
FT                   SNRQLIDQISRRSNRTRVIYGDWGSTRPREESGFASRPLDRIDYPTDGAWYIVRNKDEE
FT                   WDFKAAAEELIENSDIWDGNLNIWGEEMIYQTTINEEIGIDTPQKNVAARVNIHLHRQA
FT                   FYGAGDIGGMNLDEDWED"
     MVLENKSYVP TLAIRASEMN GLEFLPGATK DRMTPCILLA PWANSLTLDR AIDRVERAFP        60
     NRNYFLDIDR DYQFTNLESG PQQELARLME SDNAFANWVE FVGRHENAWP CIQSRGQSEA       120
     DLRRQIEAIQ ELGRPYCMRI VRDRFPSNIQ EIVAAFAAGG AADFAIILEG GWTRDPLTLS       180
     VWFEGVIAES LQEIDAAVPV VLSCTSIPKM FSAFSGITPV PFSNRQLIDQ ISRRSNRTRV       240
     IYGDWGSTRP REESGFASRP LDRIDYPTDG AWYIVRNKDE EWDFKAAAEE LIENSDIWDG       300
     NLNIWGEEMI YQTTINEEIG IDTPQKNVAA RVNIHLHRQA FYGAGDIGGM NLDEDWED         358
//

If you have problems or comments...

PBIL Back to PBIL home page