(data stored in ACNUC7421 zone)

EMBL: CP000489.PE445

CP000489.PE445       Location/Qualifiers
FT   CDS             419360..420268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpa:BPP0493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68562"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ68"
FT                   /protein_id="ABL68562.1"
FT                   /translation="MTTPPSPTLTPFLKVGIIQTSLDPAAAWAAVPKMSPCEEERAITE
FT                   IRGFFAAFHQEQPPPDIIVLPELSVPTGYEATLRRMAGKMQSIVIAGLDYRVGGKPGEV
FT                   HNEALLIVPKRWRNRKMGAKATTRRIGKTYAAPEEDKKLKSISCEFKRDPSVWLFDGDE
FT                   IGAFGVMVCYDFLDLERIAMYRGKVQHLFILALNKDATSFRHVAEAVARMVFCNVIICN
FT                   CGHFGGSLAVSPYRLSERRTIYQHAGPGLATAQIIELPVERLGLHQKGGDPLKDGIKEF
FT                   KSLPPGYQFSVALLEKLARLV"
     MTTPPSPTLT PFLKVGIIQT SLDPAAAWAA VPKMSPCEEE RAITEIRGFF AAFHQEQPPP        60
     DIIVLPELSV PTGYEATLRR MAGKMQSIVI AGLDYRVGGK PGEVHNEALL IVPKRWRNRK       120
     MGAKATTRRI GKTYAAPEED KKLKSISCEF KRDPSVWLFD GDEIGAFGVM VCYDFLDLER       180
     IAMYRGKVQH LFILALNKDA TSFRHVAEAV ARMVFCNVII CNCGHFGGSL AVSPYRLSER       240
     RTIYQHAGPG LATAQIIELP VERLGLHQKG GDPLKDGIKE FKSLPPGYQF SVALLEKLAR       300
     LV                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page