(data stored in ACNUC7421 zone)

EMBL: CP000489.PE447

CP000489.PE447       Location/Qualifiers
FT   CDS             complement(421270..421986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb2_0399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68564"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ70"
FT                   /protein_id="ABL68564.1"
FT                   /translation="MTTRLLPDIDLARIAPQRDDMKRKSLEQMKGGFSTFSYKPVRACF
FT                   SDIFNIQPDLDLGSADPTPWTVIESELRKRSKSDEEFNYNRRVALGLHDFATSGRVFGR
FT                   RQEFFPLSMGMGQKVTFWLPMILAIDEQASALFIEPRRTRGLTAEGRRFALSMMHERIR
FT                   AADEDFADVRLTIVQFSDPSDDRRAVRLHTDEGVELYSREDLEQMVASTYEMWRDVLEE
FT                   RENKARGKATGTGPLI"
     MTTRLLPDID LARIAPQRDD MKRKSLEQMK GGFSTFSYKP VRACFSDIFN IQPDLDLGSA        60
     DPTPWTVIES ELRKRSKSDE EFNYNRRVAL GLHDFATSGR VFGRRQEFFP LSMGMGQKVT       120
     FWLPMILAID EQASALFIEP RRTRGLTAEG RRFALSMMHE RIRAADEDFA DVRLTIVQFS       180
     DPSDDRRAVR LHTDEGVELY SREDLEQMVA STYEMWRDVL EERENKARGK ATGTGPLI         238
//

If you have problems or comments...

PBIL Back to PBIL home page