(data stored in ACNUC7421 zone)

EMBL: CP000489.PE448

CP000489.PE448       Location/Qualifiers
FT   CDS             complement(421964..422515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmb:BruAb2_0400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68565"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ71"
FT                   /protein_id="ABL68565.1"
FT                   /translation="MSGPYDPRAIANLMLDEADRRGWKITNLALQKLLYFAHGIHLTKT
FT                   KRPLVSGYFEAWQYGPVHPAVYRAFKPSGSAPIINRAAAKDPLTGKTRDLPKPTDLEVI
FT                   DLVSDVMRSYGHLPPGRLVDLSHAKDSPWSVVVDKARTDVAFGMRIPDDVIIARFRHHK
FT                   VSVGTSPRAGEPPSDDAPFA"
     MSGPYDPRAI ANLMLDEADR RGWKITNLAL QKLLYFAHGI HLTKTKRPLV SGYFEAWQYG        60
     PVHPAVYRAF KPSGSAPIIN RAAAKDPLTG KTRDLPKPTD LEVIDLVSDV MRSYGHLPPG       120
     RLVDLSHAKD SPWSVVVDKA RTDVAFGMRI PDDVIIARFR HHKVSVGTSP RAGEPPSDDA       180
     PFA                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page