(data stored in ACNUC7421 zone)

EMBL: CP000489.PE450

CP000489.PE450       Location/Qualifiers
FT   CDS             complement(423758..424588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68567"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ73"
FT                   /protein_id="ABL68567.1"
FT                   /translation="MLPPHRIPAIALLTFLAAAAAGAQSLPQQPGYDAFQHAVVVEPRP
FT                   YEFEILGVKPGMPIDEAVRLIEEHLGKELSPLDGTLQISSPDGRTFRTELRLGYETPGI
FT                   TFFLHNQDDQPFDSLKLDVSTPASGSVVTVVRREVRLSASDGPDGASLLAQLEDLYGEP
FT                   SETKVSPGTNSWLWATDMDYSDIAFVGGGPEPRYACVRGLPDNGRYSYEAPFLTGGPNN
FT                   CGATFGVSHRTSATTVTLNFRLTDYKLVDQDRAAANSQVDEKLTATAAPSDMKL"
     MLPPHRIPAI ALLTFLAAAA AGAQSLPQQP GYDAFQHAVV VEPRPYEFEI LGVKPGMPID        60
     EAVRLIEEHL GKELSPLDGT LQISSPDGRT FRTELRLGYE TPGITFFLHN QDDQPFDSLK       120
     LDVSTPASGS VVTVVRREVR LSASDGPDGA SLLAQLEDLY GEPSETKVSP GTNSWLWATD       180
     MDYSDIAFVG GGPEPRYACV RGLPDNGRYS YEAPFLTGGP NNCGATFGVS HRTSATTVTL       240
     NFRLTDYKLV DQDRAAANSQ VDEKLTATAA PSDMKL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page