(data stored in ACNUC7421 zone)

EMBL: CP000489.PE451

CP000489.PE451       Location/Qualifiers
FT   CDS             424675..424929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0455"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   rde:RD1_0810 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68568"
FT                   /db_xref="GOA:A1AZ74"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ74"
FT                   /protein_id="ABL68568.1"
FT                   /translation="MPDADDALLEAFAKILRKQRTAAGLSQEELAHRAGVSMRYVSLLE
FT                   SRRHQPSLATIHGLCQGLGLSMVELIGAVEAEFSERGQH"
     MPDADDALLE AFAKILRKQR TAAGLSQEEL AHRAGVSMRY VSLLESRRHQ PSLATIHGLC        60
     QGLGLSMVEL IGAVEAEFSE RGQH                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page