(data stored in ACNUC7421 zone)

EMBL: CP000489.PE453

CP000489.PE453       Location/Qualifiers
FT   CDS             425929..426456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpb:RPB_2539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68570"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ76"
FT                   /protein_id="ABL68570.1"
FT                   /translation="MNPFFRFPVLAPASRTIPARSKASARVQVVDVRSFLPQPVISRLE
FT                   SGLEAHCWDQLIADPEIREVQAQPPVIQYRDARGRPAVHHFDFRAHLADGSALAVAVRP
FT                   LARVRKYRFEDTLRLIASQLPRSFATRILLFTDADIPRPEVVPHAPTTRLIERARELGA
FT                   PMIPAFTHMILA"
     MNPFFRFPVL APASRTIPAR SKASARVQVV DVRSFLPQPV ISRLESGLEA HCWDQLIADP        60
     EIREVQAQPP VIQYRDARGR PAVHHFDFRA HLADGSALAV AVRPLARVRK YRFEDTLRLI       120
     ASQLPRSFAT RILLFTDADI PRPEVVPHAP TTRLIERARE LGAPMIPAFT HMILA            175
//

If you have problems or comments...

PBIL Back to PBIL home page