(data stored in ACNUC7421 zone)

EMBL: CP000489.PE455

CP000489.PE455       Location/Qualifiers
FT   CDS             428588..429586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0459"
FT                   /product="transposition protein, putative"
FT                   /note="KEGG: rde:RD1_0796 transposition protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68572"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ78"
FT                   /protein_id="ABL68572.1"
FT                   /translation="MTNEHHTAPDQVARIAVSLRKHFVAHPGYETVRRLFREIMDKRQA
FT                   ELDLGQSAEGRGIAVIGESGSGKTTAIQRILRRIDAADAESGEFRWISIRVPTPATQKD
FT                   LARAILHALAFQIQSNTTASRMWELVNFHLHLRKCWLIHLDEGQELGGRGSEVEKAGVI
FT                   NALKSLMQIPDWPTNLVVSGTPELHDLLTQDPQLSRRFFITRFLPVTEFDACDDVAELV
FT                   ARYAGLADLPLAPDLADVEFVPRLLHAGREQFGIVVELIIGAITRALADGHLALGIRDF
FT                   ARFYTERTGDVAGRNPFLVPDFRSLNTGRSPLEPDPPTGSKGRSRKPRGRR"
     MTNEHHTAPD QVARIAVSLR KHFVAHPGYE TVRRLFREIM DKRQAELDLG QSAEGRGIAV        60
     IGESGSGKTT AIQRILRRID AADAESGEFR WISIRVPTPA TQKDLARAIL HALAFQIQSN       120
     TTASRMWELV NFHLHLRKCW LIHLDEGQEL GGRGSEVEKA GVINALKSLM QIPDWPTNLV       180
     VSGTPELHDL LTQDPQLSRR FFITRFLPVT EFDACDDVAE LVARYAGLAD LPLAPDLADV       240
     EFVPRLLHAG REQFGIVVEL IIGAITRALA DGHLALGIRD FARFYTERTG DVAGRNPFLV       300
     PDFRSLNTGR SPLEPDPPTG SKGRSRKPRG RR                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page