(data stored in ACNUC7421 zone)

EMBL: CP000489.PE457

CP000489.PE457       Location/Qualifiers
FT   CDS             431234..432751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0461"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   sme:SMc03282 putative transposase number 1 for insertion
FT                   sequence ISRM27"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68574"
FT                   /db_xref="GOA:A1AZ80"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ80"
FT                   /protein_id="ABL68574.1"
FT                   /translation="MPGRHVTDHQTRLFMKLRQDHPIETAAAKAGLSRSTGYRIVNDPR
FT                   LPSQKKGARGRRRPDPLEHIFEAEVVPMLQSAPGLRPVAIYEEMLRRHPELQPGIRRTL
FT                   ERRIRAWRALHGEDREVMFRQVHEPGRLGLSDFTDMGALGVTITGQLLDHLLYHFRLPW
FT                   SGFEHAHVILGGESFVALAEGLQNALWSAGGAPACHRTDSLSAAFRNLDADARTDLTTR
FT                   YEALCTQYRMVPTRNNKGVAHENGAIESAHGHLKAAVRDALLMRGSADFDHLDHYRAFI
FT                   DEIVGRRNAARGKGIAAERAHLQVLPTRRTTDFEEVIVTVTGTGGFTLRKVFYTVPSRL
FT                   IGHRLRVRLFDDRLEVFTGGTHLLTLPRGRAQANGKHDQVVNYHHVIHSLRKKPMALAG
FT                   LVYRDKLFPRPEYRRAWEALNEALPARQACRITVELLALAHDRGCEAELAAEIGRVLQD
FT                   GGLPDLSILRARFSPDPEQLPVITVTSPRLSSYEALIRAPELAEARA"
     MPGRHVTDHQ TRLFMKLRQD HPIETAAAKA GLSRSTGYRI VNDPRLPSQK KGARGRRRPD        60
     PLEHIFEAEV VPMLQSAPGL RPVAIYEEML RRHPELQPGI RRTLERRIRA WRALHGEDRE       120
     VMFRQVHEPG RLGLSDFTDM GALGVTITGQ LLDHLLYHFR LPWSGFEHAH VILGGESFVA       180
     LAEGLQNALW SAGGAPACHR TDSLSAAFRN LDADARTDLT TRYEALCTQY RMVPTRNNKG       240
     VAHENGAIES AHGHLKAAVR DALLMRGSAD FDHLDHYRAF IDEIVGRRNA ARGKGIAAER       300
     AHLQVLPTRR TTDFEEVIVT VTGTGGFTLR KVFYTVPSRL IGHRLRVRLF DDRLEVFTGG       360
     THLLTLPRGR AQANGKHDQV VNYHHVIHSL RKKPMALAGL VYRDKLFPRP EYRRAWEALN       420
     EALPARQACR ITVELLALAH DRGCEAELAA EIGRVLQDGG LPDLSILRAR FSPDPEQLPV       480
     ITVTSPRLSS YEALIRAPEL AEARA                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page