(data stored in ACNUC7421 zone)

EMBL: CP000489.PE458

CP000489.PE458       Location/Qualifiers
FT   CDS             432748..433326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0462"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   sme:SMc03281 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68575"
FT                   /db_xref="GOA:A1AZ81"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ81"
FT                   /protein_id="ABL68575.1"
FT                   /translation="MKPASHTVDGARLGIMLNELRLPTIKTLWPRFAEQADREGWPAAR
FT                   FLAAIAEHELAERAHRRIARHLAEAHLPPGKTLDSFAFEAVPMISKAQVSAMAAGDSWL
FT                   AKGANVLMFGPPGGGKSHLAAAIGLALIENGWRVLFTRTTDLVQKLQVARRELQLEAAI
FT                   AKLDKFDLLILDDLAYAHPVCRAAAASSR"
     MKPASHTVDG ARLGIMLNEL RLPTIKTLWP RFAEQADREG WPAARFLAAI AEHELAERAH        60
     RRIARHLAEA HLPPGKTLDS FAFEAVPMIS KAQVSAMAAG DSWLAKGANV LMFGPPGGGK       120
     SHLAAAIGLA LIENGWRVLF TRTTDLVQKL QVARRELQLE AAIAKLDKFD LLILDDLAYA       180
     HPVCRAAAAS SR                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page