(data stored in ACNUC7421 zone)

EMBL: CP000489.PE460

CP000489.PE460       Location/Qualifiers
FT   CDS             434326..435324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0464"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: nha:Nham_3955
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68577"
FT                   /db_xref="GOA:A1AZ83"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ83"
FT                   /protein_id="ABL68577.1"
FT                   /translation="MLAIDLAKGSFQVCAVAADGAVLYNRVMSRTRLAALLAEQPACVV
FT                   AMEACATSHHWGRMAQSHGHEVRLVPAVYVKPFVKRQKNDRADAEAIAEAALRPTMRFV
FT                   AVKSADTQGRAVAFRTHQCLVRQRTQLINALRGHLAEFGLVAPKGPASLKVLENALADP
FT                   ASDVPGPVREMGAIYVEQIARLTEVIGRLAEELEAASRTDTQLRRLCTIPRIGPVTAGA
FT                   VAAFAPDLDTFDSGRNFAAWLGLVPRQRSTGGKTRLGSVSKMGQTDIRRLLIVGAMSVI
FT                   RWVVRKGGSANRWLAALVMRKPKMVAAVALANKMARMIWALTTKEQDYRMA"
     MLAIDLAKGS FQVCAVAADG AVLYNRVMSR TRLAALLAEQ PACVVAMEAC ATSHHWGRMA        60
     QSHGHEVRLV PAVYVKPFVK RQKNDRADAE AIAEAALRPT MRFVAVKSAD TQGRAVAFRT       120
     HQCLVRQRTQ LINALRGHLA EFGLVAPKGP ASLKVLENAL ADPASDVPGP VREMGAIYVE       180
     QIARLTEVIG RLAEELEAAS RTDTQLRRLC TIPRIGPVTA GAVAAFAPDL DTFDSGRNFA       240
     AWLGLVPRQR STGGKTRLGS VSKMGQTDIR RLLIVGAMSV IRWVVRKGGS ANRWLAALVM       300
     RKPKMVAAVA LANKMARMIW ALTTKEQDYR MA                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page