(data stored in ACNUC7421 zone)

EMBL: CP000489.PE461

CP000489.PE461       Location/Qualifiers
FT   CDS             436286..437371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0466"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: psb:Psyr_4615
FT                   spermidine/putrescine ABC transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68578"
FT                   /db_xref="GOA:A1AZ84"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ84"
FT                   /protein_id="ABL68578.1"
FT                   /translation="MSRQPFISFNSVSKSYDHDRWVVEDLCLDVREGEFLTLLGPSGSG
FT                   KSTTLMMLAGFEQPTTGDILRRGRSLHSIAPHKRNIGIVFQDYALFPHMKIGDNIGYPL
FT                   RMRGLRGADVARKVEKALDMVDMSNLSSRYPHQLSGGQRQRVALARALVFDPDLVLLDE
FT                   PLGALDNQLRIRMQAEIKRLHAATGVTFVAVTHDQNEALSMSDRIAIFNNGRVQQIDET
FT                   RKIYDQPATAFVAQFIGDSNILPAQLVDHGAGQVRVTVADMGTLLATKQTLTPEGANMA
FT                   VAIRQERIVVSPVAANCDNRFSGQVSELAFLGDQIRVQIHIGDHRINVRRPISEFVEIP
FT                   TEGDWFEVGWSPTDCWVLPET"
     MSRQPFISFN SVSKSYDHDR WVVEDLCLDV REGEFLTLLG PSGSGKSTTL MMLAGFEQPT        60
     TGDILRRGRS LHSIAPHKRN IGIVFQDYAL FPHMKIGDNI GYPLRMRGLR GADVARKVEK       120
     ALDMVDMSNL SSRYPHQLSG GQRQRVALAR ALVFDPDLVL LDEPLGALDN QLRIRMQAEI       180
     KRLHAATGVT FVAVTHDQNE ALSMSDRIAI FNNGRVQQID ETRKIYDQPA TAFVAQFIGD       240
     SNILPAQLVD HGAGQVRVTV ADMGTLLATK QTLTPEGANM AVAIRQERIV VSPVAANCDN       300
     RFSGQVSELA FLGDQIRVQI HIGDHRINVR RPISEFVEIP TEGDWFEVGW SPTDCWVLPE       360
     T                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page