(data stored in ACNUC7421 zone)

EMBL: CP000489.PE462

CP000489.PE462       Location/Qualifiers
FT   CDS             437384..438448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0467"
FT                   /product="putative spermidine/putrescine-binding protein"
FT                   /note="KEGG: bmb:BruAb2_0855 hypothetical
FT                   spermidine/putrescine ABC transporter, periplasmic
FT                   spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68579"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ85"
FT                   /protein_id="ABL68579.1"
FT                   /translation="MGTAMEKHEFYAAMVLASITATICGPYQSLADQITIASWGGNVTD
FT                   ANRAAYWEPFTTESGIAVVDDVFNGEIAKLRVQVETGSIQWDIAEVEDAEAIVGCDEGL
FT                   YEFLVIDTLPIDDMLPGTVTDCGIASLSAASVLTYNGTKFEEGPKTWTDFFNLNAFPGK
FT                   RGLRKSPTYTLEFALLADGVPREEIYEVLATPEGQDRAFAMLDRIKDEIVWYSSGTQQI
FT                   QGFISGEYDIGVGFNARVADANREQRVDLRMSWNAGYIVGHNFWVVLAGSSRIEEVRKF
FT                   LEFVTRPDRQAAFMEYIDYGSSNRESYKLLPEDRKTYLPGAGDHAEYQISYDAQFWSNH
FT                   LDQLTERFNRWIGE"
     MGTAMEKHEF YAAMVLASIT ATICGPYQSL ADQITIASWG GNVTDANRAA YWEPFTTESG        60
     IAVVDDVFNG EIAKLRVQVE TGSIQWDIAE VEDAEAIVGC DEGLYEFLVI DTLPIDDMLP       120
     GTVTDCGIAS LSAASVLTYN GTKFEEGPKT WTDFFNLNAF PGKRGLRKSP TYTLEFALLA       180
     DGVPREEIYE VLATPEGQDR AFAMLDRIKD EIVWYSSGTQ QIQGFISGEY DIGVGFNARV       240
     ADANREQRVD LRMSWNAGYI VGHNFWVVLA GSSRIEEVRK FLEFVTRPDR QAAFMEYIDY       300
     GSSNRESYKL LPEDRKTYLP GAGDHAEYQI SYDAQFWSNH LDQLTERFNR WIGE             354
//

If you have problems or comments...

PBIL Back to PBIL home page