(data stored in ACNUC7421 zone)

EMBL: CP000489.PE463

CP000489.PE463       Location/Qualifiers
FT   CDS             438445..439695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0468"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ppu:PP_0413 polyamine ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68580"
FT                   /db_xref="GOA:A1AZ86"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ86"
FT                   /protein_id="ABL68580.1"
FT                   /translation="MIEAAAKYAHSATWWQRTKLFGDRSNRAAWLLLLPSMVLVALAFL
FT                   MPLGGFLWRAVDNSALSRKLPATIEAVQMWDHRTEPTETLAAAMMSDLATQAEQRGGMA
FT                   AVARELNDLLPSFRNVIMRTGRALTQPPQTVSAMEWLGAVDQQWREPDVWIAVKSNDGY
FT                   LTDRYLLTTLGLERSIDKGLTRASVDKRIYADVLVRTLWMSFVVTAATLLLAYPLAYAL
FT                   AHAPSRWRGLVLCAIMLPFLTSLLVRTLAWVIILQKHGVLNQLLIGTGIAERPLSLLYT
FT                   RGAVYLGMIHILLPFMVLPIRNSMQRIPPSHMKAALSLGATPLRAFLNVYLPATLPGIG
FT                   AGVLIVGVLTLGFYITPEFLGGSKDQMVSYFVSFFTNRSVNWGMASAMGIWLLVLAVAL
FT                   VGTLRWLTQHFNPERQG"
     MIEAAAKYAH SATWWQRTKL FGDRSNRAAW LLLLPSMVLV ALAFLMPLGG FLWRAVDNSA        60
     LSRKLPATIE AVQMWDHRTE PTETLAAAMM SDLATQAEQR GGMAAVAREL NDLLPSFRNV       120
     IMRTGRALTQ PPQTVSAMEW LGAVDQQWRE PDVWIAVKSN DGYLTDRYLL TTLGLERSID       180
     KGLTRASVDK RIYADVLVRT LWMSFVVTAA TLLLAYPLAY ALAHAPSRWR GLVLCAIMLP       240
     FLTSLLVRTL AWVIILQKHG VLNQLLIGTG IAERPLSLLY TRGAVYLGMI HILLPFMVLP       300
     IRNSMQRIPP SHMKAALSLG ATPLRAFLNV YLPATLPGIG AGVLIVGVLT LGFYITPEFL       360
     GGSKDQMVSY FVSFFTNRSV NWGMASAMGI WLLVLAVALV GTLRWLTQHF NPERQG           416
//

If you have problems or comments...

PBIL Back to PBIL home page