(data stored in ACNUC7421 zone)

EMBL: CP000489.PE467

CP000489.PE467       Location/Qualifiers
FT   CDS             442556..444619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0472"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   reu:Reut_C6223 5-oxoprolinase (ATP-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68584"
FT                   /db_xref="GOA:A1AZ90"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ90"
FT                   /protein_id="ABL68584.1"
FT                   /translation="MRLASDTGGTFTDLVVEEDDGRITMYKSPTVPDDPVLGVLRALEL
FT                   AAEDRGLSLQELMARADTFIHGTTHAINAIITGNVARTALLVTKGHRDILVFREGGRVE
FT                   PFNQSIPFPRPYIPRDLTYEIPERILSTGAIHRDLDEAAVIGVLQSLKEQQVEAVAVCL
FT                   LWATINPAHELRVGELIAEHLPGVPYTLAHDVNPTLREFRRASSAAIDASLKPLMGHYL
FT                   SGLTDRIRGEGFTGDIMLLTSSGGMVDAAEVARSPIKVINSGPSMAPISGHYYARAEAQ
FT                   ADDVIVADTGGTTYDISLVRKGVVPITRELWIGRPLLGHLVGYPSVEVKSVGAGGGSIA
FT                   HVDQGGLLRVGPQSAGAKPGPVCYRQGGTKPTVTDASVALGHIDPDFFLGGRIKLDRPA
FT                   AIEAIRKQVAEPLGMSVDEASWQIIALATEGMVQAIADITVAQGIDPANAVLIGGGGAA
FT                   GLNSTFIARRLGCKSLVIPETGAALSAAGAMMSPLISEYATSIFVSSDRFDREALAAAI
FT                   ERLRAKCEDFASRSPAASGAPRISFVAEARYEGQVWDIDVKFDPQKILGPDGSEIFRAG
FT                   FDDMHEQIFAVRDPGSAVEIIGIRATLRADIRRDVEFRLHSPGALSGDHRPREIYFHGY
FT                   GRLQTPVLRLEAIAPGRPGQGPAIIESAFTTIVVDPDARFHRSGTGSIVIHP"
     MRLASDTGGT FTDLVVEEDD GRITMYKSPT VPDDPVLGVL RALELAAEDR GLSLQELMAR        60
     ADTFIHGTTH AINAIITGNV ARTALLVTKG HRDILVFREG GRVEPFNQSI PFPRPYIPRD       120
     LTYEIPERIL STGAIHRDLD EAAVIGVLQS LKEQQVEAVA VCLLWATINP AHELRVGELI       180
     AEHLPGVPYT LAHDVNPTLR EFRRASSAAI DASLKPLMGH YLSGLTDRIR GEGFTGDIML       240
     LTSSGGMVDA AEVARSPIKV INSGPSMAPI SGHYYARAEA QADDVIVADT GGTTYDISLV       300
     RKGVVPITRE LWIGRPLLGH LVGYPSVEVK SVGAGGGSIA HVDQGGLLRV GPQSAGAKPG       360
     PVCYRQGGTK PTVTDASVAL GHIDPDFFLG GRIKLDRPAA IEAIRKQVAE PLGMSVDEAS       420
     WQIIALATEG MVQAIADITV AQGIDPANAV LIGGGGAAGL NSTFIARRLG CKSLVIPETG       480
     AALSAAGAMM SPLISEYATS IFVSSDRFDR EALAAAIERL RAKCEDFASR SPAASGAPRI       540
     SFVAEARYEG QVWDIDVKFD PQKILGPDGS EIFRAGFDDM HEQIFAVRDP GSAVEIIGIR       600
     ATLRADIRRD VEFRLHSPGA LSGDHRPREI YFHGYGRLQT PVLRLEAIAP GRPGQGPAII       660
     ESAFTTIVVD PDARFHRSGT GSIVIHP                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page