(data stored in ACNUC7421 zone)

EMBL: CP000489.PE470

CP000489.PE470       Location/Qualifiers
FT   CDS             447146..447538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68587"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ93"
FT                   /protein_id="ABL68587.1"
FT                   /translation="MGKLTGSEGKANRMAVDVALDPNRMTDAGPDPGRGQPDGAMPRHD
FT                   DQAAALRRRYPGRCPHTFGRSQADVAAGKVFVAGISPLQSSGGEPEIGRPGQVARRPRA
FT                   ALRGIHTGTVTRPKGRGEIVEARSGA"
     MGKLTGSEGK ANRMAVDVAL DPNRMTDAGP DPGRGQPDGA MPRHDDQAAA LRRRYPGRCP        60
     HTFGRSQADV AAGKVFVAGI SPLQSSGGEP EIGRPGQVAR RPRAALRGIH TGTVTRPKGR       120
     GEIVEARSGA                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page