(data stored in ACNUC7421 zone)

EMBL: CP000489.PE472

CP000489.PE472       Location/Qualifiers
FT   CDS             448044..448658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0477"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2,
FT                   conserved barrel domain protein; KEGG: bur:Bcep18194_B1227
FT                   transcriptional regulator, XRE family with cupin sensor
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68589"
FT                   /db_xref="GOA:A1AZ95"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ95"
FT                   /protein_id="ABL68589.1"
FT                   /translation="MARKIEGTRIQSGLPERLRALRERKGWSLNRAAEEVGVPPSTLSR
FT                   IENRKMSPTLDLLLKIVRTFDMHPNDVFSGRPDQQEKQEISVSRASDPALIELPNLFYK
FT                   HLHPDMECFNFRAILITLFARSVEEYGGLTAHSGQEFVYLLSGKLQVHLEGHPLVTLAP
FT                   GDSIMFTSSIPHAYVSAGDSQAKLLIASSSEEDVLQVKFQK"
     MARKIEGTRI QSGLPERLRA LRERKGWSLN RAAEEVGVPP STLSRIENRK MSPTLDLLLK        60
     IVRTFDMHPN DVFSGRPDQQ EKQEISVSRA SDPALIELPN LFYKHLHPDM ECFNFRAILI       120
     TLFARSVEEY GGLTAHSGQE FVYLLSGKLQ VHLEGHPLVT LAPGDSIMFT SSIPHAYVSA       180
     GDSQAKLLIA SSSEEDVLQV KFQK                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page