(data stored in ACNUC7421 zone)

EMBL: CP000489.PE478

CP000489.PE478       Location/Qualifiers
FT   CDS             453266..453667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0483"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein, PINc; KEGG: sme:SMa0981 probable NtrR2
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68595"
FT                   /db_xref="GOA:A1AZA1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA1"
FT                   /protein_id="ABL68595.1"
FT                   /translation="MTLYMLDTNIVSDLLRHPDGSAAKRIAEVGPDAICVSIITAAELR
FT                   YGCARKGSAKLLAHVEAILENVQVLALDVPADAEYGGIRAELEAAGKPIGPNDLLIAAH
FT                   AYAAGAILVTDNTGEFSRVRGLRVENWIR"
     MTLYMLDTNI VSDLLRHPDG SAAKRIAEVG PDAICVSIIT AAELRYGCAR KGSAKLLAHV        60
     EAILENVQVL ALDVPADAEY GGIRAELEAA GKPIGPNDLL IAAHAYAAGA ILVTDNTGEF       120
     SRVRGLRVEN WIR                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page