(data stored in ACNUC7421 zone)

EMBL: CP000489.PE481

CP000489.PE481       Location/Qualifiers
FT   CDS             455218..455601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc01416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68598"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA4"
FT                   /protein_id="ABL68598.1"
FT                   /translation="MSTLNIHLDTGANLRTGFTEAGELAVIVNTREAIPALYFRSYEDL
FT                   HRVLTPSRLRVVMALAGQGVMSIDELARRVGRDAPAVHQDVITLADAGVIDHTEKGAEF
FT                   PHRGIHLDFWVDLSDGNMQRHEQ"
     MSTLNIHLDT GANLRTGFTE AGELAVIVNT REAIPALYFR SYEDLHRVLT PSRLRVVMAL        60
     AGQGVMSIDE LARRVGRDAP AVHQDVITLA DAGVIDHTEK GAEFPHRGIH LDFWVDLSDG       120
     NMQRHEQ                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page