(data stored in ACNUC7421 zone)

EMBL: CP000489.PE484

CP000489.PE484       Location/Qualifiers
FT   CDS             complement(460736..461500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsp:RSP_1148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68601"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA7"
FT                   /protein_id="ABL68601.1"
FT                   /translation="MASRPSINPMGRGMALAAGTAAMLTLPVLPAQAANFTPPAGCKLE
FT                   VTVQNRGCSVSQHYRCSADTAGDQWVTYFTPEGPTFQSRIDRETRWMESTDLRTGLTDV
FT                   LEDQAQDHASFSTLLDSGQDDFDFWTRSNSGERLHHVGHDELTGETVQVDGVTLEVTRF
FT                   ELTTYSESGQVLIQRRGQQFISRAQGRFYGGVETSEDWTGAVQQTNDSPVTFSFPGHPG
FT                   FGSTTPEYDCDLQMVGGQGAGALWQLVKEART"
     MASRPSINPM GRGMALAAGT AAMLTLPVLP AQAANFTPPA GCKLEVTVQN RGCSVSQHYR        60
     CSADTAGDQW VTYFTPEGPT FQSRIDRETR WMESTDLRTG LTDVLEDQAQ DHASFSTLLD       120
     SGQDDFDFWT RSNSGERLHH VGHDELTGET VQVDGVTLEV TRFELTTYSE SGQVLIQRRG       180
     QQFISRAQGR FYGGVETSED WTGAVQQTND SPVTFSFPGH PGFGSTTPEY DCDLQMVGGQ       240
     GAGALWQLVK EART                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page