(data stored in ACNUC7421 zone)

EMBL: CP000489.PE485

CP000489.PE485       Location/Qualifiers
FT   CDS             complement(461513..463006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0490"
FT                   /product="glutamate synthase (NADPH) small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="TIGRFAM: glutamate synthase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sit:TM1040_2822 glutamate synthase,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68602"
FT                   /db_xref="GOA:A1AZA8"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZA8"
FT                   /protein_id="ABL68602.1"
FT                   /translation="MATQKMLKFVTIGREMPEKRDAASRSEDFHEIYREFAEAKAKEQA
FT                   SRCSQCGVPYCQSHCPLHNNIPDWLRLTAEGRTQEAYLRSQETNTFPEICGRICPQDRL
FT                   CEGNCVIEQSGHGTVTIGAIEKYITDTAWEEGWITPVAPTQERPESIGIIGAGPGGLAA
FT                   ADRLRRMGFQVTVYDRHDRAGGLLIYGIPGFKLEKQVVERRTQQLVEGGVDFVLNVSVG
FT                   EDISFDAIRGKHDAVLIATGVYKTRDLDIDNAAAKGVVRALDYLTASNRVDLGDEIPDY
FT                   EDGELNARGKRVVVIGGGDTAMDCVRTAIRQGAQSVKCLYRRDRANMPGSQREVQNAEE
FT                   EGVEFVWLSAPGAFTGHVTGEAMVAQERDVDDTGEIPTISAVRVQKMRLGAPDVSGRQS
FT                   PELIEGADYDEPAELVIKALGFEPEELPRLWGVDGLEVTRWGTIKADYQTHQTSLPGVY
FT                   AVGDIVRGASLVVWAIRDGREAADSIAGYLSGAARVAAE"
     MATQKMLKFV TIGREMPEKR DAASRSEDFH EIYREFAEAK AKEQASRCSQ CGVPYCQSHC        60
     PLHNNIPDWL RLTAEGRTQE AYLRSQETNT FPEICGRICP QDRLCEGNCV IEQSGHGTVT       120
     IGAIEKYITD TAWEEGWITP VAPTQERPES IGIIGAGPGG LAAADRLRRM GFQVTVYDRH       180
     DRAGGLLIYG IPGFKLEKQV VERRTQQLVE GGVDFVLNVS VGEDISFDAI RGKHDAVLIA       240
     TGVYKTRDLD IDNAAAKGVV RALDYLTASN RVDLGDEIPD YEDGELNARG KRVVVIGGGD       300
     TAMDCVRTAI RQGAQSVKCL YRRDRANMPG SQREVQNAEE EGVEFVWLSA PGAFTGHVTG       360
     EAMVAQERDV DDTGEIPTIS AVRVQKMRLG APDVSGRQSP ELIEGADYDE PAELVIKALG       420
     FEPEELPRLW GVDGLEVTRW GTIKADYQTH QTSLPGVYAV GDIVRGASLV VWAIRDGREA       480
     ADSIAGYLSG AARVAAE                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page