(data stored in ACNUC7421 zone)

EMBL: CP000489.PE486

CP000489.PE486       Location/Qualifiers
FT   CDS             complement(463157..463960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0491"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="KEGG: rsp:RSP_1150 undecaprenyl pyrophosphate
FT                   phosphatase; TIGRFAM: putative undecaprenol kinase; PFAM:
FT                   Bacitracin resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68603"
FT                   /db_xref="GOA:A1AZA9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZA9"
FT                   /protein_id="ABL68603.1"
FT                   /translation="MDHNTIVAAALGLLEGLTEFIPVSSTGHVLLAGHFLGFDSPGRAF
FT                   EVLIQLGAIMAILGVYAGRLWRIFSSAPQDPRARRFILAVLLAFLPAVVIGVLAHRIIK
FT                   EVLFETPTLIAVMLIVGGVVLLFVDRMANRPRHFSAEDFPLPMALKIGFIQCLAMIPGV
FT                   SRSGATIVGALLLGADKRSAAEFSFFLSMPTMLGAFVYDLYKNRDILDAAATGNIVIGF
FT                   VCAFLAAVVVVRGLLNYVSTYGYGLFAWWRIAVGVAVLLALQAGW"
     MDHNTIVAAA LGLLEGLTEF IPVSSTGHVL LAGHFLGFDS PGRAFEVLIQ LGAIMAILGV        60
     YAGRLWRIFS SAPQDPRARR FILAVLLAFL PAVVIGVLAH RIIKEVLFET PTLIAVMLIV       120
     GGVVLLFVDR MANRPRHFSA EDFPLPMALK IGFIQCLAMI PGVSRSGATI VGALLLGADK       180
     RSAAEFSFFL SMPTMLGAFV YDLYKNRDIL DAAATGNIVI GFVCAFLAAV VVVRGLLNYV       240
     STYGYGLFAW WRIAVGVAVL LALQAGW                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page