(data stored in ACNUC7421 zone)

EMBL: CP000489.PE487

CP000489.PE487       Location/Qualifiers
FT   CDS             complement(463960..464952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0492"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility C-terminal domain; KEGG: sit:TM1040_2820 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68604"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB0"
FT                   /protein_id="ABL68604.1"
FT                   /translation="MSAAKLVTIYGGSGFLGRQIARTMAAQGWRIRVAVRRPNEAGVVR
FT                   TYGAPGQVEPVPCNVRDDLSVTACMADADAVINCVGIMVREGKNTFDAIHEEAAGRIAR
FT                   IAAETGVKRFVHVSAIGADPDSASRYAASKGRGEAAVLAHRPDAMILRPSVIFGPDDHF
FT                   YNRIASMTRLGPILFVPGANTLMQPVYVEDVARAAAMGAEGTAQPGIYELGGPDMLTMR
FT                   EVAQQVLVAIDRRRAIVGLPHWLARVTGSALDLVQAATGGLLTNRILTRDQARLLRLPN
FT                   RVSGEVKTFADLDIEPTAAPAVIADYLWRFRSSGQYEAITASAKNLRNS"
     MSAAKLVTIY GGSGFLGRQI ARTMAAQGWR IRVAVRRPNE AGVVRTYGAP GQVEPVPCNV        60
     RDDLSVTACM ADADAVINCV GIMVREGKNT FDAIHEEAAG RIARIAAETG VKRFVHVSAI       120
     GADPDSASRY AASKGRGEAA VLAHRPDAMI LRPSVIFGPD DHFYNRIASM TRLGPILFVP       180
     GANTLMQPVY VEDVARAAAM GAEGTAQPGI YELGGPDMLT MREVAQQVLV AIDRRRAIVG       240
     LPHWLARVTG SALDLVQAAT GGLLTNRILT RDQARLLRLP NRVSGEVKTF ADLDIEPTAA       300
     PAVIADYLWR FRSSGQYEAI TASAKNLRNS                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page