(data stored in ACNUC7421 zone)

EMBL: CP000489.PE49

CP000489.PE49        Location/Qualifiers
FT   CDS             41478..42287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0049"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sit:TM1040_0114 ABC transporter related; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68166"
FT                   /db_xref="GOA:A1AY22"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY22"
FT                   /protein_id="ABL68166.1"
FT                   /translation="MTQTTITPDGRQIGDVLMDLRNITLRFGGVTAIKDISFDIREGEI
FT                   RAIIGPNGAGKSSMLNVISGFYVPQEGEIWFKGYRRGPMKPYEVARLGIARTFQNIALF
FT                   DGMSVLDNIMTGRLNMMKAPIWSQALWWGRAEREEVENREQVEKIIDFLEIQNIRKTPV
FT                   GRLPYGLKKRVELARALAAEPKILLLDEPMAGMNVEEKEDMCRFILDVNDEFGTTIALI
FT                   EHDMGVVMDLSDRVVVMDYGRKIGDGTPDEVRNNPEVISAYLGVAHE"
     MTQTTITPDG RQIGDVLMDL RNITLRFGGV TAIKDISFDI REGEIRAIIG PNGAGKSSML        60
     NVISGFYVPQ EGEIWFKGYR RGPMKPYEVA RLGIARTFQN IALFDGMSVL DNIMTGRLNM       120
     MKAPIWSQAL WWGRAEREEV ENREQVEKII DFLEIQNIRK TPVGRLPYGL KKRVELARAL       180
     AAEPKILLLD EPMAGMNVEE KEDMCRFILD VNDEFGTTIA LIEHDMGVVM DLSDRVVVMD       240
     YGRKIGDGTP DEVRNNPEVI SAYLGVAHE                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page