(data stored in ACNUC7421 zone)

EMBL: CP000489.PE490

CP000489.PE490       Location/Qualifiers
FT   CDS             complement(467633..468904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0495"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein; KEGG: rde:RD1_0413 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68607"
FT                   /db_xref="GOA:A1AZB3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB3"
FT                   /protein_id="ABL68607.1"
FT                   /translation="MMIIDAQALSSVPHGWRLVLLVDDSRAQRRTLAVQLIRAGYHVVE
FT                   AASGDEAMRICLERRPDIVISDWMMPGQSGLEFCRRFREMQSDRYGYFILLTSRNDKKD
FT                   IAEGLRAGADEFLTKPVSGAELLARLSASERILRMEESLRSANARLNSTLTRLRETQAA
FT                   IDRDLREAQRLQQGLVRERHGRYGDFDLSLLMRPAGHIGGDLVGFFPINARRVGLFALD
FT                   VAGHGVASALLCARLAALLSGAADQNIALRITELGLCDARPPAEILHHLNTLMIEELRT
FT                   ESYFTMVYADLDFLTGALRLVQAGHPHPVLQRADGRIESIGRGGLPVGVFSHAAYEEVQ
FT                   LVLDPGDRLFISSDGLSESENARGEPLGEDGLHAILRTNATLRGDSLLESICWSAAHYA
FT                   GGQRNDDISAVLIERRQEAGQTWG"
     MMIIDAQALS SVPHGWRLVL LVDDSRAQRR TLAVQLIRAG YHVVEAASGD EAMRICLERR        60
     PDIVISDWMM PGQSGLEFCR RFREMQSDRY GYFILLTSRN DKKDIAEGLR AGADEFLTKP       120
     VSGAELLARL SASERILRME ESLRSANARL NSTLTRLRET QAAIDRDLRE AQRLQQGLVR       180
     ERHGRYGDFD LSLLMRPAGH IGGDLVGFFP INARRVGLFA LDVAGHGVAS ALLCARLAAL       240
     LSGAADQNIA LRITELGLCD ARPPAEILHH LNTLMIEELR TESYFTMVYA DLDFLTGALR       300
     LVQAGHPHPV LQRADGRIES IGRGGLPVGV FSHAAYEEVQ LVLDPGDRLF ISSDGLSESE       360
     NARGEPLGED GLHAILRTNA TLRGDSLLES ICWSAAHYAG GQRNDDISAV LIERRQEAGQ       420
     TWG                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page