(data stored in ACNUC7421 zone)

EMBL: CP000489.PE491

CP000489.PE491       Location/Qualifiers
FT   CDS             469024..469374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0496"
FT                   /product="Hpt protein"
FT                   /note="PFAM: Hpt domain protein; KEGG: sit:TM1040_2886 Hpt
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68608"
FT                   /db_xref="GOA:A1AZB4"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZB4"
FT                   /protein_id="ABL68608.1"
FT                   /translation="MLDWSRINELRGEVGDDEFQLILELFLDEVEGVIMRLSRRDALRL
FT                   ETDLHFLKGCASNLGFADFGDLCDACERKAAGGRPAEVDIESLLASYAASKRALMGRLD
FT                   AALHPGRGGRRA"
     MLDWSRINEL RGEVGDDEFQ LILELFLDEV EGVIMRLSRR DALRLETDLH FLKGCASNLG        60
     FADFGDLCDA CERKAAGGRP AEVDIESLLA SYAASKRALM GRLDAALHPG RGGRRA           116
//

If you have problems or comments...

PBIL Back to PBIL home page