(data stored in ACNUC7421 zone)

EMBL: CP000489.PE497

CP000489.PE497       Location/Qualifiers
FT   CDS             complement(474003..474617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0502"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /note="KEGG: rsp:RSP_0986 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68614"
FT                   /db_xref="GOA:A1AZC0"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC0"
FT                   /protein_id="ABL68614.1"
FT                   /translation="MEEILDRIAGLGPGRRVLAVLGAPGSGKSTLAAQLAAGLDDAVLV
FT                   PMDGFHLDNRLLEADGRRGCKGAPETFDAAGFVALVQRLKAGGEVIHPIFDRALDLAIA
FT                   GAGRVEAETRLVVVEGNYLLLDRDPWRELAGLWDLSVMLDVPMEELRRRLTARWQGLGR
FT                   SPAEVMAHLENDLGNAELVLRESLPADLVVRPGPISSAETP"
     MEEILDRIAG LGPGRRVLAV LGAPGSGKST LAAQLAAGLD DAVLVPMDGF HLDNRLLEAD        60
     GRRGCKGAPE TFDAAGFVAL VQRLKAGGEV IHPIFDRALD LAIAGAGRVE AETRLVVVEG       120
     NYLLLDRDPW RELAGLWDLS VMLDVPMEEL RRRLTARWQG LGRSPAEVMA HLENDLGNAE       180
     LVLRESLPAD LVVRPGPISS AETP                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page