(data stored in ACNUC7421 zone)

EMBL: CP000489.PE498

CP000489.PE498       Location/Qualifiers
FT   CDS             complement(474658..475452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0503"
FT                   /product="ribose ABC transporter ATP-binding protein /
FT                   fructose ABC transporter ATP-binding protein / mannose ABC
FT                   transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sme:SMc02169 putative ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68615"
FT                   /db_xref="GOA:A1AZC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC1"
FT                   /protein_id="ABL68615.1"
FT                   /translation="MTANISGEPLLKARGLVKRYGKVTALDHCDFDLLPGEILAVIGDN
FT                   GAGKSSLIKALSGAVQPDEGEIALEGKPVRFANPLDARGYGIECVYQTLAMSPALSIAD
FT                   NMFMGRELRKPGIMGQWFRKLDRPAMEKFAREKLTELGLMTIQNINQAVETLSGGQRQG
FT                   VAVARAAAFGSKVVILDEPTAALGVKESRRVLELIRDVRSRGIPIILISHNMPHVFEVA
FT                   DRIHIHRLGRRLCVIRPDDYSMSDAVAFMTGAKLPEEAATAA"
     MTANISGEPL LKARGLVKRY GKVTALDHCD FDLLPGEILA VIGDNGAGKS SLIKALSGAV        60
     QPDEGEIALE GKPVRFANPL DARGYGIECV YQTLAMSPAL SIADNMFMGR ELRKPGIMGQ       120
     WFRKLDRPAM EKFAREKLTE LGLMTIQNIN QAVETLSGGQ RQGVAVARAA AFGSKVVILD       180
     EPTAALGVKE SRRVLELIRD VRSRGIPIIL ISHNMPHVFE VADRIHIHRL GRRLCVIRPD       240
     DYSMSDAVAF MTGAKLPEEA ATAA                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page