(data stored in ACNUC7421 zone)

EMBL: CP000489.PE499

CP000489.PE499       Location/Qualifiers
FT   CDS             complement(475449..476522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0504"
FT                   /product="fructose ABC transporter membrane protein /
FT                   mannose ABC transporter membrane protein / ribose ABC
FT                   transporter membrane protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rsp:RSP_0989 ABC sugar transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68616"
FT                   /db_xref="GOA:A1AZC2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC2"
FT                   /protein_id="ABL68616.1"
FT                   /translation="MSSDAKTAASYEEGLQGASDKVAEFQEQKTALKRLQHWLHMTPSA
FT                   VPMIVLVAAIVVFGLLSPNFFKAVTLSTILQQIAIVGILGCAQSLVVLTAGIDLSVGAI
FT                   AVFSSVLMGQFTFRYGIPAPLAIALGLAAGTAMGFANGWLVARIKLPPFIVTLGTWQII
FT                   LAANYIYSANETIRSSAIAAEAPALQFWGYSIQPGGVKILYAVFLMVALVALLAYVLRH
FT                   TAWGRHVYAVGDDPEAAELAGVRTKRVLIQVYVLAGLFCAIAGWVMIGRFGSVSPSAST
FT                   GQLGNIQSITAVVIGGISLFGGRGSIVGMFFGALIVGVFEMGLKMVGTDPQWTFFLIGL
FT                   LIILAVAVDQWIRKASA"
     MSSDAKTAAS YEEGLQGASD KVAEFQEQKT ALKRLQHWLH MTPSAVPMIV LVAAIVVFGL        60
     LSPNFFKAVT LSTILQQIAI VGILGCAQSL VVLTAGIDLS VGAIAVFSSV LMGQFTFRYG       120
     IPAPLAIALG LAAGTAMGFA NGWLVARIKL PPFIVTLGTW QIILAANYIY SANETIRSSA       180
     IAAEAPALQF WGYSIQPGGV KILYAVFLMV ALVALLAYVL RHTAWGRHVY AVGDDPEAAE       240
     LAGVRTKRVL IQVYVLAGLF CAIAGWVMIG RFGSVSPSAS TGQLGNIQSI TAVVIGGISL       300
     FGGRGSIVGM FFGALIVGVF EMGLKMVGTD PQWTFFLIGL LIILAVAVDQ WIRKASA          357
//

If you have problems or comments...

PBIL Back to PBIL home page