(data stored in ACNUC7421 zone)

EMBL: CP000489.PE50

CP000489.PE50        Location/Qualifiers
FT   CDS             42298..43278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0050"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rsp:RSP_2277 ABC branched amino acid transporter family,
FT                   inner membrane subunit; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68167"
FT                   /db_xref="GOA:A1AY23"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY23"
FT                   /protein_id="ABL68167.1"
FT                   /translation="MEFLYASEVLLNGLMAGVMYSLVALGFVLIYKASGIFNYAQGVMA
FT                   LFAAMTLVGIMEGRVPFAHLINAAFGVHLSSFGWTVPGLLAILLTALIMVGLAIAIEKL
FT                   VLKHLVGQEPIILFMATIGLAWFLEGLGDVMWGADVKVLDVGLPQGISETVETMTDGLF
FT                   GYGFFIDRLDIWATVIAAVLVAALVGFSQYTKQGRAMRAVADDHQAALSVGISLQFIWI
FT                   MVWSIAGFVALVAGIMWGTKSGVQFSLSLIALKALPVLMLGGFTSIPGAIVGGLIIGMG
FT                   EKLFEYFVGPAVGGATENWFAYVLALLFLVFRPQGLFGERIIERV"
     MEFLYASEVL LNGLMAGVMY SLVALGFVLI YKASGIFNYA QGVMALFAAM TLVGIMEGRV        60
     PFAHLINAAF GVHLSSFGWT VPGLLAILLT ALIMVGLAIA IEKLVLKHLV GQEPIILFMA       120
     TIGLAWFLEG LGDVMWGADV KVLDVGLPQG ISETVETMTD GLFGYGFFID RLDIWATVIA       180
     AVLVAALVGF SQYTKQGRAM RAVADDHQAA LSVGISLQFI WIMVWSIAGF VALVAGIMWG       240
     TKSGVQFSLS LIALKALPVL MLGGFTSIPG AIVGGLIIGM GEKLFEYFVG PAVGGATENW       300
     FAYVLALLFL VFRPQGLFGE RIIERV                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page