(data stored in ACNUC7421 zone)

EMBL: CP000489.PE501

CP000489.PE501       Location/Qualifiers
FT   CDS             477754..478944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0506"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; regulatory protein, MarR;
FT                   KEGG: rsp:RSP_0991 putative transcriptional regulator, ROK
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68618"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC4"
FT                   /protein_id="ABL68618.1"
FT                   /translation="MPNTNPAATPQGVRSQNERQILWLIRRNGPMPRAALAQATGLSAQ
FT                   AVTNITRELIAAGLLDAGGERRRGKVGQPLLPLALAPEGALFLGLKVGRRVAELVLVDF
FT                   AGRIRQIRLLPHAYPHPDAIRDFAIAGVAEILAGLTDAQHARLAGMGIASPFYLWDWAE
FT                   EMQPWRGRDLRTELAEALDLPVWLENDGSCACGAEMMFGTDELPQDFLYFYIAHFAGGG
FT                   VVLEGRLRLGPSRNAGAMGSYPVPGGRQVLDVASISVLEAALGGDLPLDDADWQVPPAI
FT                   AREWLDESARVLSHAALGAVAVLDLPLVVIDGAMPAALRAALVQGTAASLAAMRHHGVT
FT                   LPEVRAGTLGRRARTLGAAALPLGAGFLPGGSFSAPRPGRDGHETRDARPRSRDDR"
     MPNTNPAATP QGVRSQNERQ ILWLIRRNGP MPRAALAQAT GLSAQAVTNI TRELIAAGLL        60
     DAGGERRRGK VGQPLLPLAL APEGALFLGL KVGRRVAELV LVDFAGRIRQ IRLLPHAYPH       120
     PDAIRDFAIA GVAEILAGLT DAQHARLAGM GIASPFYLWD WAEEMQPWRG RDLRTELAEA       180
     LDLPVWLEND GSCACGAEMM FGTDELPQDF LYFYIAHFAG GGVVLEGRLR LGPSRNAGAM       240
     GSYPVPGGRQ VLDVASISVL EAALGGDLPL DDADWQVPPA IAREWLDESA RVLSHAALGA       300
     VAVLDLPLVV IDGAMPAALR AALVQGTAAS LAAMRHHGVT LPEVRAGTLG RRARTLGAAA       360
     LPLGAGFLPG GSFSAPRPGR DGHETRDARP RSRDDR                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page