(data stored in ACNUC7421 zone)

EMBL: CP000489.PE502

CP000489.PE502       Location/Qualifiers
FT   CDS             478963..479877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0507"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: sme:SMa0116 putative
FT                   DnaJ/CbpA-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68619"
FT                   /db_xref="GOA:A1AZC5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC5"
FT                   /protein_id="ABL68619.1"
FT                   /translation="MADDPYKALGLGKNASQDDIKKAYRRIAKTDHPDLNPDPAAHERF
FT                   KAASSAYDLLKDPEQRARFDRGEIDAQGQEQPQRHYYREYAESGDNPYRQHHGFDDLSD
FT                   VFSDLFGGRGGGGGGRRGGARSFDMRGSDQRFTLEIDFMTAARGGSTRITMPDGSVLEV
FT                   KIPEGAHDGQVIRLRGKGGPGMGNGEPGDALLTLIVAEDPDWHRDGNDVETTLPITIDE
FT                   AVLGGKVEAQTIDGPVMLTVPRGASSGRKLRLKGRGIKGADGRRGDQHVVLKIVMPPQI
FT                   DSELARFMEDWRQNHAYDPRRGK"
     MADDPYKALG LGKNASQDDI KKAYRRIAKT DHPDLNPDPA AHERFKAASS AYDLLKDPEQ        60
     RARFDRGEID AQGQEQPQRH YYREYAESGD NPYRQHHGFD DLSDVFSDLF GGRGGGGGGR       120
     RGGARSFDMR GSDQRFTLEI DFMTAARGGS TRITMPDGSV LEVKIPEGAH DGQVIRLRGK       180
     GGPGMGNGEP GDALLTLIVA EDPDWHRDGN DVETTLPITI DEAVLGGKVE AQTIDGPVML       240
     TVPRGASSGR KLRLKGRGIK GADGRRGDQH VVLKIVMPPQ IDSELARFME DWRQNHAYDP       300
     RRGK                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page