(data stored in ACNUC7421 zone)

EMBL: CP000489.PE503

CP000489.PE503       Location/Qualifiers
FT   CDS             479874..480221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rru:Rru_A2016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68620"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZC6"
FT                   /protein_id="ABL68620.1"
FT                   /translation="MTQPHYTLTQTLESVGGLTSEQLERYISAGVVVPVQSEQGPLFRE
FT                   IDLARLNLVVDLAEGYHLDEEALALVLSLVDQLHGLRGDMRAILDAVAREPVETRVRLK
FT                   AAIREVRVVTR"
     MTQPHYTLTQ TLESVGGLTS EQLERYISAG VVVPVQSEQG PLFREIDLAR LNLVVDLAEG        60
     YHLDEEALAL VLSLVDQLHG LRGDMRAILD AVAREPVETR VRLKAAIREV RVVTR            115
//

If you have problems or comments...

PBIL Back to PBIL home page