(data stored in ACNUC7421 zone)

EMBL: CP000489.PE51

CP000489.PE51        Location/Qualifiers
FT   CDS             43354..44460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0051"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rsp:RSP_2276 ABC branched amino acid transporter family,
FT                   inner membrane subunit; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68168"
FT                   /db_xref="GOA:A1AY24"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY24"
FT                   /protein_id="ABL68168.1"
FT                   /translation="MSKRRSREGRMFYREAGDFKTSYRDDGQTFPIKLDRWGYYAILAV
FT                   AFLVVPLVIDSYWANAVLVPFLIYAIAALGLNILTGYAGQVSLGTGGFMAVGAYAVYKL
FT                   MVAFPGVPIVVHIILAGAITAVVGMLFGLPSLRIKGFYLAVATLAAQFFLVWLFNKVPW
FT                   FYNYSASGQINAPERTILGWAVTGPATSASAKYLICLCFAVGLAWMARNLTRGSVGRKW
FT                   MAIRDMDIAAEIIGVNPLTAKLSAFAVSSFFVGIAGALLFSVYLGAAEASEAFGINKSF
FT                   LVLFMIIIGGLGSIFGSFAGAAFLVLLPVLLKNVLVAQFGWPTDLAAHIELMIVGALIV
FT                   FFLIVEPHGLARLWALTKEKLRLWPFPH"
     MSKRRSREGR MFYREAGDFK TSYRDDGQTF PIKLDRWGYY AILAVAFLVV PLVIDSYWAN        60
     AVLVPFLIYA IAALGLNILT GYAGQVSLGT GGFMAVGAYA VYKLMVAFPG VPIVVHIILA       120
     GAITAVVGML FGLPSLRIKG FYLAVATLAA QFFLVWLFNK VPWFYNYSAS GQINAPERTI       180
     LGWAVTGPAT SASAKYLICL CFAVGLAWMA RNLTRGSVGR KWMAIRDMDI AAEIIGVNPL       240
     TAKLSAFAVS SFFVGIAGAL LFSVYLGAAE ASEAFGINKS FLVLFMIIIG GLGSIFGSFA       300
     GAAFLVLLPV LLKNVLVAQF GWPTDLAAHI ELMIVGALIV FFLIVEPHGL ARLWALTKEK       360
     LRLWPFPH                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page