(data stored in ACNUC7421 zone)

EMBL: CP000489.PE511

CP000489.PE511       Location/Qualifiers
FT   CDS             487599..488117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0516"
FT                   /product="Sarcosine oxidase, gamma subunit"
FT                   /note="PFAM: Sarcosine oxidase, gamma subunit; KEGG:
FT                   rsp:RSP_2690 putative sarcosine oxidase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68628"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD4"
FT                   /protein_id="ABL68628.1"
FT                   /translation="MAEALARISQVQDWGMIQIRADLSRAGDAIAEAAGVALPGQGRIT
FT                   TDGSRTLGWMSPDELLLVLPRAETAEALAALQDALATEHALVLDVSDMRAVFRIQGAKA
FT                   LDVLMKLCPADLAAMPQDGLRRTRAAQVACGIWRETDGYVLIGFRSVTDYLRGILTGAA
FT                   VPGTQLDPR"
     MAEALARISQ VQDWGMIQIR ADLSRAGDAI AEAAGVALPG QGRITTDGSR TLGWMSPDEL        60
     LLVLPRAETA EALAALQDAL ATEHALVLDV SDMRAVFRIQ GAKALDVLMK LCPADLAAMP       120
     QDGLRRTRAA QVACGIWRET DGYVLIGFRS VTDYLRGILT GAAVPGTQLD PR               172
//

If you have problems or comments...

PBIL Back to PBIL home page