(data stored in ACNUC7421 zone)

EMBL: CP000489.PE514

CP000489.PE514       Location/Qualifiers
FT   CDS             489405..489929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0519"
FT                   /product="protein of unknown function DUF461"
FT                   /note="PFAM: protein of unknown function DUF461; KEGG:
FT                   rde:RD1_1682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68631"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD7"
FT                   /protein_id="ABL68631.1"
FT                   /translation="MVRTPRGGMGMRPASSGARLGPMREDEEMKPLLPALCLGLIPLAA
FT                   PAQDAALAVHDGYARAANPRSGAAFMVIENRGAAACTLSSVASDAAERAELHTHRDEGG
FT                   VMRMVKADPIQIPAGARHELVRGGDHVMLMGLKHPLADGDQLALTLDFGSCGEVQAHLP
FT                   VDNKRMPGHAH"
     MVRTPRGGMG MRPASSGARL GPMREDEEMK PLLPALCLGL IPLAAPAQDA ALAVHDGYAR        60
     AANPRSGAAF MVIENRGAAA CTLSSVASDA AERAELHTHR DEGGVMRMVK ADPIQIPAGA       120
     RHELVRGGDH VMLMGLKHPL ADGDQLALTL DFGSCGEVQA HLPVDNKRMP GHAH             174
//

If you have problems or comments...

PBIL Back to PBIL home page