(data stored in ACNUC7421 zone)

EMBL: CP000489.PE515

CP000489.PE515       Location/Qualifiers
FT   CDS             complement(489926..490564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0520"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L family; KEGG:
FT                   rsp:RSP_3601 lipolytic enzyme, G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68632"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZD8"
FT                   /protein_id="ABL68632.1"
FT                   /translation="MMLRTLVLILALAAVPAAATPLRILAFGDSLTEGYGLPRKDGLVP
FT                   QLQDWLRARGHDVLVLNGGLSGDTTAGGRVRIGYSLARHKPDAVIVELGGNDLLMGFAP
FT                   QMVEGNLDSILGQAGRGGRPLLLVGIASPDHDDPLRRDWAGIWPRMATQHDALLMENLY
FT                   QPLFDLPGDGYKAMLQPDGLHASAKGVGLIVQSLGPKVEALIEKAEARR"
     MMLRTLVLIL ALAAVPAAAT PLRILAFGDS LTEGYGLPRK DGLVPQLQDW LRARGHDVLV        60
     LNGGLSGDTT AGGRVRIGYS LARHKPDAVI VELGGNDLLM GFAPQMVEGN LDSILGQAGR       120
     GGRPLLLVGI ASPDHDDPLR RDWAGIWPRM ATQHDALLME NLYQPLFDLP GDGYKAMLQP       180
     DGLHASAKGV GLIVQSLGPK VEALIEKAEA RR                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page