(data stored in ACNUC7421 zone)

EMBL: CP000489.PE518

CP000489.PE518       Location/Qualifiers
FT   CDS             493991..495088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0523"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: rsp:RSP_3604
FT                   rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68635"
FT                   /db_xref="GOA:A1AZE1"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE1"
FT                   /protein_id="ABL68635.1"
FT                   /translation="MDIRLKSLSDPALSGFDTIIDTRSPLEFAEDHLPGAINLPVLSDE
FT                   ERVQVGTIYKQVSPFDARKLGGAMVAANAARHIAGPLAGFGGGWRPLVYCWRGGQRSGA
FT                   FATILQQIGWRVGRIEGGYKAWRALVVERVTAAVAAPVVVLDGNTGSAKTEILHRLAAR
FT                   GHQVIDLEGFANHRGSLFGAMPGGQPSQKLFECRLAMALEALDPGRPLLVEAESSRIGD
FT                   LNLPRGIWQAIVAAPRLRLAVPVEARAAYTARAYADTCADPQAVARIVNLLRPLHPADR
FT                   IEAWLRMIAAADWSGLAEGLMRDHYDPRYERHRARHDDGRGPVVALDGLDDLDAAAARV
FT                   EAALAGLTLPRPAPAASPVASGGSI"
     MDIRLKSLSD PALSGFDTII DTRSPLEFAE DHLPGAINLP VLSDEERVQV GTIYKQVSPF        60
     DARKLGGAMV AANAARHIAG PLAGFGGGWR PLVYCWRGGQ RSGAFATILQ QIGWRVGRIE       120
     GGYKAWRALV VERVTAAVAA PVVVLDGNTG SAKTEILHRL AARGHQVIDL EGFANHRGSL       180
     FGAMPGGQPS QKLFECRLAM ALEALDPGRP LLVEAESSRI GDLNLPRGIW QAIVAAPRLR       240
     LAVPVEARAA YTARAYADTC ADPQAVARIV NLLRPLHPAD RIEAWLRMIA AADWSGLAEG       300
     LMRDHYDPRY ERHRARHDDG RGPVVALDGL DDLDAAAARV EAALAGLTLP RPAPAASPVA       360
     SGGSI                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page