(data stored in ACNUC7421 zone)

EMBL: CP000489.PE522

CP000489.PE522       Location/Qualifiers
FT   CDS             complement(498015..499640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0527"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sil:SPO0378 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68639"
FT                   /db_xref="GOA:A1AZE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE5"
FT                   /protein_id="ABL68639.1"
FT                   /translation="MPAAGALHGAPAIELRGISKAFGPVQANKDIDLVVPRGTIHGIIG
FT                   ENGAGKSTLMSILYGFYRPDAGEILIGGKPIAIADSQAAIRAGIGMVFQHFKLVQNFTV
FT                   LENVILGAEDGGLLRPSLSRARGALKRLASEYGLQVDPDALVEELSVGHQQRVEILKAL
FT                   YRQADILILDEPTGVLTPAEADHLFRILRGLRDEGKTIILITHKLREIMEITDNVSVMR
FT                   RGEMVASVKTAETGPAQLAELMVGRKVLLRVEKPPARPGAPVLEVRGLRMVDADGVERL
FT                   RGIDLEIRAGEILGIAGVAGNGQTQLLEVLGGFPEAGAKLQGEIRLNGKPLPLGGAGAD
FT                   GRARRQAGVGHVPEDRQAEGLIMDFTAWENVAFGYHHAPEFQNGMLMDNAAIRADAMGK
FT                   IQHFDIRPPNPDLAARNFSGGNQQKIVVAREVERNPDLLLIGQPTRGVDIGAIEFIHKR
FT                   IVALRDAGKAVLLVSVELDEIMALSDRIAVMFDGRIMGERLADEATTGDLGCLMAGVDP
FT                   ALTPPEAAIPPAAAPGTDAGGGAG"
     MPAAGALHGA PAIELRGISK AFGPVQANKD IDLVVPRGTI HGIIGENGAG KSTLMSILYG        60
     FYRPDAGEIL IGGKPIAIAD SQAAIRAGIG MVFQHFKLVQ NFTVLENVIL GAEDGGLLRP       120
     SLSRARGALK RLASEYGLQV DPDALVEELS VGHQQRVEIL KALYRQADIL ILDEPTGVLT       180
     PAEADHLFRI LRGLRDEGKT IILITHKLRE IMEITDNVSV MRRGEMVASV KTAETGPAQL       240
     AELMVGRKVL LRVEKPPARP GAPVLEVRGL RMVDADGVER LRGIDLEIRA GEILGIAGVA       300
     GNGQTQLLEV LGGFPEAGAK LQGEIRLNGK PLPLGGAGAD GRARRQAGVG HVPEDRQAEG       360
     LIMDFTAWEN VAFGYHHAPE FQNGMLMDNA AIRADAMGKI QHFDIRPPNP DLAARNFSGG       420
     NQQKIVVARE VERNPDLLLI GQPTRGVDIG AIEFIHKRIV ALRDAGKAVL LVSVELDEIM       480
     ALSDRIAVMF DGRIMGERLA DEATTGDLGC LMAGVDPALT PPEAAIPPAA APGTDAGGGA       540
     G                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page