(data stored in ACNUC7421 zone)

EMBL: CP000489.PE525

CP000489.PE525       Location/Qualifiers
FT   CDS             complement(501116..501709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0530"
FT                   /product="peptidase M22, glycoprotease"
FT                   /note="PFAM: peptidase M22, glycoprotease; KEGG:
FT                   rsp:RSP_2213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68642"
FT                   /db_xref="GOA:A1AZE8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE8"
FT                   /protein_id="ABL68642.1"
FT                   /translation="MADALSLGFDTSAAHCAAALLQGDRVLFHRHEEMARGQAERLFPL
FT                   LDEVLAAAGIGWRDLSVIGCGIGPGNFTGIRISVAAARGLSLSLGIPAIGVSVTEAAAH
FT                   GLPRPCRVAVPSRTGEVIWQDFGTGQATGPQQCASHDLPPGPAPLPPAMPLAEAIARFA
FT                   AARRDQPDLPRPAPIYLRPADAAPARDRGPLILS"
     MADALSLGFD TSAAHCAAAL LQGDRVLFHR HEEMARGQAE RLFPLLDEVL AAAGIGWRDL        60
     SVIGCGIGPG NFTGIRISVA AARGLSLSLG IPAIGVSVTE AAAHGLPRPC RVAVPSRTGE       120
     VIWQDFGTGQ ATGPQQCASH DLPPGPAPLP PAMPLAEAIA RFAAARRDQP DLPRPAPIYL       180
     RPADAAPARD RGPLILS                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page