(data stored in ACNUC7421 zone)

EMBL: CP000489.PE526

CP000489.PE526       Location/Qualifiers
FT   CDS             complement(501702..502256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0531"
FT                   /product="nitrogen-fixing NifU domain protein"
FT                   /note="PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   sit:TM1040_3091 nitrogen-fixing NifU-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68643"
FT                   /db_xref="GOA:A1AZE9"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZE9"
FT                   /protein_id="ABL68643.1"
FT                   /translation="MFIQTETTPNPATLKFLPGETVLGSGTADFPAPDTAAASPLARRI
FT                   FAVPGVTGVFLGSDFVTVTKAEDAVWDHLKPSVLGAIMEHYQSGAPAIEGATASGHNDQ
FT                   DGPDAEIVNQIKELLDTRVRPAVAQDGGDITFHGFDRGVVYLHMQGACAGCPSSTLTLK
FT                   MGIENLLRHYIPEVTEVRPVG"
     MFIQTETTPN PATLKFLPGE TVLGSGTADF PAPDTAAASP LARRIFAVPG VTGVFLGSDF        60
     VTVTKAEDAV WDHLKPSVLG AIMEHYQSGA PAIEGATASG HNDQDGPDAE IVNQIKELLD       120
     TRVRPAVAQD GGDITFHGFD RGVVYLHMQG ACAGCPSSTL TLKMGIENLL RHYIPEVTEV       180
     RPVG                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page