(data stored in ACNUC7421 zone)

EMBL: CP000489.PE527

CP000489.PE527       Location/Qualifiers
FT   CDS             complement(502470..502925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0532"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: sit:TM1040_3730
FT                   UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68644"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZF0"
FT                   /protein_id="ABL68644.1"
FT                   /translation="MRKFLVVLDDSRECLNAIRYAALRAAKTGGGVQVLAVIPANAIQH
FT                   GMGVADVMRAEAYERIEAHYEVFAKWMRDRPGIEPELVVREGEPGAELLAQIHDDPEIG
FT                   VVVLAASTESAGPGPLVTRLTREVASLPCPVTIVPGDISRERLEQIT"
     MRKFLVVLDD SRECLNAIRY AALRAAKTGG GVQVLAVIPA NAIQHGMGVA DVMRAEAYER        60
     IEAHYEVFAK WMRDRPGIEP ELVVREGEPG AELLAQIHDD PEIGVVVLAA STESAGPGPL       120
     VTRLTREVAS LPCPVTIVPG DISRERLEQI T                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page