(data stored in ACNUC7421 zone)

EMBL: CP000489.PE53

CP000489.PE53        Location/Qualifiers
FT   CDS             45839..46663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0053"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsp:RSP_2274 ABC branched amino acid transporter
FT                   family, ATPase subunit; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68170"
FT                   /db_xref="GOA:A1AY26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY26"
FT                   /protein_id="ABL68170.1"
FT                   /translation="MFDAAPQRETLLEVNNIEVIYNHVILVLKGVSLSVPKGGITALLG
FT                   GNGAGKTTTLKAISNLLHSERGEVTKGSISYRGERIQDMDPASVVKKGIIQVMEGRHCF
FT                   EHLTIEENLLTGAYTRTDGSAAIRQDLEMVYSYFPRLKERRKSQAGYTSGGEQQMCAMG
FT                   RALMSRPETILLDEPSMGLAPQLVEQIFEIVKAVNEGEGVTFLLAEQNTNVALRYAHYG
FT                   YILESGRVVMDGPADALRENPDVKEFYLGMSDQGRKSFRDVRSYRRRKRWLA"
     MFDAAPQRET LLEVNNIEVI YNHVILVLKG VSLSVPKGGI TALLGGNGAG KTTTLKAISN        60
     LLHSERGEVT KGSISYRGER IQDMDPASVV KKGIIQVMEG RHCFEHLTIE ENLLTGAYTR       120
     TDGSAAIRQD LEMVYSYFPR LKERRKSQAG YTSGGEQQMC AMGRALMSRP ETILLDEPSM       180
     GLAPQLVEQI FEIVKAVNEG EGVTFLLAEQ NTNVALRYAH YGYILESGRV VMDGPADALR       240
     ENPDVKEFYL GMSDQGRKSF RDVRSYRRRK RWLA                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page