(data stored in ACNUC7421 zone)

EMBL: CP000489.PE536

CP000489.PE536       Location/Qualifiers
FT   CDS             512830..515391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0541"
FT                   /product="pyruvate phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="PFAM: PEP-utilizing enzyme; PEP-utilising enzyme,
FT                   mobile region; KEGG: rsp:RSP_1859 pyruvate phosphate
FT                   dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68653"
FT                   /db_xref="GOA:A1AZF9"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZF9"
FT                   /protein_id="ABL68653.1"
FT                   /translation="MTALTDPGAIVEITPSAGIQTARHGWRAKCLQRLVRMELPVPTSF
FT                   ALSAEAVRAIAAGQMPDRARLAAMVERADGLVSVRPSAMNPAWGGPGTVLNVGINHACH
FT                   ARLVQTRGKAAADAIYLGFVQSYAIHVARLDPDMFSDSEGGLEAALRAYEDETDEEFPQ
FT                   DPARQLAEVLRSMARAWDGPTARLLRQAKGAPPLAPLGLVVQDMALAIGPGVTGSGTIQ
FT                   FIDSVTGAPRITGRFRGQTQGRSKGEGAETLYLTRDPRGPSLEEAAPEVFADLVRFGVA
FT                   ARERLREEMQIEFVVSDSRLSIIDAVRVSRNSRASVRIAVALARDGIIPPEEAVMRVEP
FT                   RALSDLLHHQVDPRAPRDVIARGINASPGAATGRIVFTAAAAQAAEARGERCVLVRRET
FT                   VPEDIRGMHAAVAVLTERGGMTSHAAVIARGIGLPCIVGASGISIDPRARTMLVGGRLF
FT                   HEGEEITIDGTSGEVLAGAAEMLEPALDDGFTQLLEWADAHCRIKIRANADTPEDARTA
FT                   RMFNAQGIGLCRTEHMFFDDERLPAMREMIFAGKPEDRSLSLERLLPMQRSDFAALFEI
FT                   MAGLPVTIRLFDPPLHEFLPHDREGMRELAESLDLPLSDVTRRVEALSEFNPMLGMRGV
FT                   RLGITVPEIYDMQARAIFEATIEASRNGDPVVPEIMIPLVSARREVELVKTRIDAVAAA
FT                   VRNETRKDFTYRLGVMVETPRAALRAGDIAEHSAFLSFGTNDLTQMTYGLSRDDAGRFM
FT                   GTYVSQGVYSEDPFHILDFDGVGELVAIGTERARDHKPDITIAVCGEHGGNPESIAFCL
FT                   RTGVNYVSCSPFRVPVARLAAAQESILMGREEAESSVEVES"
     MTALTDPGAI VEITPSAGIQ TARHGWRAKC LQRLVRMELP VPTSFALSAE AVRAIAAGQM        60
     PDRARLAAMV ERADGLVSVR PSAMNPAWGG PGTVLNVGIN HACHARLVQT RGKAAADAIY       120
     LGFVQSYAIH VARLDPDMFS DSEGGLEAAL RAYEDETDEE FPQDPARQLA EVLRSMARAW       180
     DGPTARLLRQ AKGAPPLAPL GLVVQDMALA IGPGVTGSGT IQFIDSVTGA PRITGRFRGQ       240
     TQGRSKGEGA ETLYLTRDPR GPSLEEAAPE VFADLVRFGV AARERLREEM QIEFVVSDSR       300
     LSIIDAVRVS RNSRASVRIA VALARDGIIP PEEAVMRVEP RALSDLLHHQ VDPRAPRDVI       360
     ARGINASPGA ATGRIVFTAA AAQAAEARGE RCVLVRRETV PEDIRGMHAA VAVLTERGGM       420
     TSHAAVIARG IGLPCIVGAS GISIDPRART MLVGGRLFHE GEEITIDGTS GEVLAGAAEM       480
     LEPALDDGFT QLLEWADAHC RIKIRANADT PEDARTARMF NAQGIGLCRT EHMFFDDERL       540
     PAMREMIFAG KPEDRSLSLE RLLPMQRSDF AALFEIMAGL PVTIRLFDPP LHEFLPHDRE       600
     GMRELAESLD LPLSDVTRRV EALSEFNPML GMRGVRLGIT VPEIYDMQAR AIFEATIEAS       660
     RNGDPVVPEI MIPLVSARRE VELVKTRIDA VAAAVRNETR KDFTYRLGVM VETPRAALRA       720
     GDIAEHSAFL SFGTNDLTQM TYGLSRDDAG RFMGTYVSQG VYSEDPFHIL DFDGVGELVA       780
     IGTERARDHK PDITIAVCGE HGGNPESIAF CLRTGVNYVS CSPFRVPVAR LAAAQESILM       840
     GREEAESSVE VES                                                          853
//

If you have problems or comments...

PBIL Back to PBIL home page