(data stored in ACNUC7421 zone)

EMBL: CP000489.PE537

CP000489.PE537       Location/Qualifiers
FT   CDS             515619..516158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0542"
FT                   /product="cell wall hydrolase, SleB"
FT                   /note="PFAM: cell wall hydrolase, SleB; KEGG: rsp:RSP_1860
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68654"
FT                   /db_xref="GOA:A1AZG0"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG0"
FT                   /protein_id="ABL68654.1"
FT                   /translation="MSISKSWLTRVSVCVAVALSPVAAVPAMADGQHQVAYETKKGRAA
FT                   RQATVQINPTDLQCLSEALYFEARGEGVQGQQAVAEVILNRVDHPRFPKTVCGVVNQRG
FT                   QFTYNKGARIREKGTYARVQKVAMAALAGAPRTLTNGATYFHTRAVRPSWSKRFERTTR
FT                   IGSHIFYRSDRRLASN"
     MSISKSWLTR VSVCVAVALS PVAAVPAMAD GQHQVAYETK KGRAARQATV QINPTDLQCL        60
     SEALYFEARG EGVQGQQAVA EVILNRVDHP RFPKTVCGVV NQRGQFTYNK GARIREKGTY       120
     ARVQKVAMAA LAGAPRTLTN GATYFHTRAV RPSWSKRFER TTRIGSHIFY RSDRRLASN        179
//

If you have problems or comments...

PBIL Back to PBIL home page