(data stored in ACNUC7421 zone)

EMBL: CP000489.PE540

CP000489.PE540       Location/Qualifiers
FT   CDS             518046..519389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0545"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase C terminal;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: rsp:RSP_1863
FT                   phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68657"
FT                   /db_xref="GOA:A1AZG3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZG3"
FT                   /protein_id="ABL68657.1"
FT                   /translation="MSRKLFGTDGVRGRANTHPMTAEMALRLGAAAGRYFRRSGEDHHR
FT                   VVIGKDTRLSGYMLENALTAGLTSTGMNVLLLGPVPTPAVGYLTRSMRADVGIMISASH
FT                   NPAHDNGIKFFGPDGFKLSDEAEARIEAIVAGEIIPAQPQNIGRAKRIDDGRGRYVEYA
FT                   KTTFPSGQRLEGLKVVVDCANGAAYRAAPDVLWELGAEVIPLGVSPNGHNINDGLGSTH
FT                   PEACARAVLEHGADMGISLDGDADRVMIVDEKGQVADGDQIMALLAARWAAQGRLRGGA
FT                   LVATVMSNLGLERFLQGRGLRLERTAVGDRYVVERMRGAGFNLGGEQSGHIVMTDYATT
FT                   GDGLIASLQFLAALSDSGQRASELVAQFEPVPQLLKNVRYAVGADPLSKDSVQAEIARA
FT                   EARLNGSGRVLIRKSGTEPLIRVMAEAEDETVLREVVEDIVAAVEKAA"
     MSRKLFGTDG VRGRANTHPM TAEMALRLGA AAGRYFRRSG EDHHRVVIGK DTRLSGYMLE        60
     NALTAGLTST GMNVLLLGPV PTPAVGYLTR SMRADVGIMI SASHNPAHDN GIKFFGPDGF       120
     KLSDEAEARI EAIVAGEIIP AQPQNIGRAK RIDDGRGRYV EYAKTTFPSG QRLEGLKVVV       180
     DCANGAAYRA APDVLWELGA EVIPLGVSPN GHNINDGLGS THPEACARAV LEHGADMGIS       240
     LDGDADRVMI VDEKGQVADG DQIMALLAAR WAAQGRLRGG ALVATVMSNL GLERFLQGRG       300
     LRLERTAVGD RYVVERMRGA GFNLGGEQSG HIVMTDYATT GDGLIASLQF LAALSDSGQR       360
     ASELVAQFEP VPQLLKNVRY AVGADPLSKD SVQAEIARAE ARLNGSGRVL IRKSGTEPLI       420
     RVMAEAEDET VLREVVEDIV AAVEKAA                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page