(data stored in ACNUC7421 zone)

EMBL: CP000489.PE543

CP000489.PE543       Location/Qualifiers
FT   CDS             521219..522058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0548"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5; SMART:
FT                   AAA ATPase; KEGG: rsp:RSP_2653 ATPase, AAA family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68660"
FT                   /db_xref="GOA:A1AZG6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZG6"
FT                   /protein_id="ABL68660.1"
FT                   /translation="MQFSSTETYVAPPDLAMAVNAAITLERPLLVKGEPGTGKTELARQ
FT                   VAASLDLPIVEWNVKSTTRAQQGLYEYDAVSRLRDSQLGEARVHDIANYIRKGKLWQAF
FT                   EAPGKVVLLIDEIDKADIEFPNDLLQELDRMEFHVYETGEMVQARHRPVVIITSNNEKE
FT                   LPDAFLRRCFFHYIRFPDAETLKRIVEVHYPGLKHRILDEALSQFLELREVQGLKKKPS
FT                   TSELLDWLKLILAEDLSPEDLKRPAGEMLPKLHGALLKNEQDVALFERLAFMARRQR"
     MQFSSTETYV APPDLAMAVN AAITLERPLL VKGEPGTGKT ELARQVAASL DLPIVEWNVK        60
     STTRAQQGLY EYDAVSRLRD SQLGEARVHD IANYIRKGKL WQAFEAPGKV VLLIDEIDKA       120
     DIEFPNDLLQ ELDRMEFHVY ETGEMVQARH RPVVIITSNN EKELPDAFLR RCFFHYIRFP       180
     DAETLKRIVE VHYPGLKHRI LDEALSQFLE LREVQGLKKK PSTSELLDWL KLILAEDLSP       240
     EDLKRPAGEM LPKLHGALLK NEQDVALFER LAFMARRQR                              279
//

If you have problems or comments...

PBIL Back to PBIL home page